SCOPe 2.08: Domain d6ziib_: 6zii B:

Lineage for d6ziib_ (6zii B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [401548] (1 PDB entry)

8. Domain d6ziib_: 6zii B: [401549]
   automated match to d3cz5a_
   complexed with mg

Details for d6ziib_

PDB Entry: 6zii, 2.5 Å

PDB Description: structure of the isolated rec domain of rcsb from salmonella enterica serovar typhimurium in the presence of phosphomimetic bef3-

PDB Compounds: (B:) Transcriptional regulatory protein RcsB

SCOPe Domain Sequences for d6ziib_:

Sequence; same for both SEQRES and ATOM records:

>d6ziib_ c.23.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
nnmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmpg
dkygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkala
alqkgkkftpesvsrlle

Timeline for d6ziib_:

• d6ziib_ first appeared in SCOPe 2.07