SCOP 1.73: Domain d1gsna3: 1gsn A:364-478

Lineage for d1gsna3 (1gsn A:364-478)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Glutathione reductase [55426] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries)

8. Domain d1gsna3: 1gsn A:364-478 [40154]
   Other proteins in same PDB: d1gsna1, d1gsna2
   complexed with fad, gtt, po4

Details for d1gsna3

PDB Entry: 1gsn, 1.7 Å

PDB Description: human glutathione reductase modified by dinitrosoglutathione

PDB Compounds: (A:) glutathione reductase

SCOP Domain Sequences for d1gsna3:

Sequence; same for both SEQRES and ATOM records:

>d1gsna3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

Timeline for d1gsna3:

• d1gsna3 first appeared (with stable ids) in SCOP 1.55, called d1gsn_3
  
• d1gsna3 was called d1gsn_3 in SCOP 1.71
  
• d1gsna3 appears in SCOP 1.75
  
• d1gsna3 appears in the current release, SCOPe 2.08