SCOPe 2.07: Domain d6zg3e1: 6zg3 E:1-125

Lineage for d6zg3e1 (6zg3 E:1-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d6zg3e1: 6zg3 E:1-125 [401522]
   Other proteins in same PDB: d6zg3e2, d6zg3j2
   automated match to d5hggs_
   complexed with cit, lmt, peg

Details for d6zg3e1

PDB Entry: 6zg3, 2.8 Å

PDB Description: the structure of ecf pant transporter in a complex with a nanobody

PDB Compounds: (E:) CA14381 nanobody

SCOPe Domain Sequences for d6zg3e1:

Sequence; same for both SEQRES and ATOM records:

>d6zg3e1 b.1.1.1 (E:1-125) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqpggslrlsctasgftlddyaigwfrqapgkeregiscisrsgsstty
adsvkgrftisrdraentvylqmnslkpedtadyycaatpvwywscavkvgpydywgqgt
qvtvs

Timeline for d6zg3e1:

• d6zg3e1 is new in SCOPe 2.07-stable
  
• d6zg3e1 appears in the current release, SCOPe 2.08