Lineage for d1ap8__ (1ap8 -)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.86: Translation initiation factor eIF4e [55417] (1 superfamily)
beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478Superfamily d.86.1: Translation initiation factor eIF4e [55418] (1 family) 
Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein) Protein Translation initiation factor eIF4e [55420] (2 species)
messenger RNA 5' cap-binding protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55422] (2 PDB entries) 
Domain d1ap8__: 1ap8 - [40151]
Details for d1ap8__
PDB Entry: 1ap8 (more details)
PDB Description: translation initiation factor eif4e in complex with m7gdp, nmr, 20 structures
SCOP Domain Sequences for d1ap8__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ap8__ d.86.1.1 (-) Translation initiation factor eIF4e {Baker's yeast (Saccharomyces cerevisiae)}
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlr
gkgadidelwlrtllavigetideddsqingvvlsirkggnkfalwtksedkepllrigg
kfkqvlkltddghleffphssangrhpqpsitl
SCOP Domain Coordinates for d1ap8__:
Click to download the PDB-style file with coordinates for d1ap8__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ap8__:
- d1ap8__ first appeared (with stable ids) in SCOP 1.55
- d1ap8__ appears in SCOP 1.67
- d1ap8__ appears in SCOP 1.71
- d1ap8__ appears in the current release, SCOPe 2.08, called d1ap8a_
View in 3D