Lineage for d1ap8__ (1ap8 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81979Fold d.86: Translation initiation factor eIF4e [55417] (1 superfamily)
  4. 81980Superfamily d.86.1: Translation initiation factor eIF4e [55418] (1 family) (S)
  5. 81981Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
  6. 81982Protein Translation initiation factor eIF4e [55420] (2 species)
  7. 81983Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55422] (1 PDB entry)
  8. 81984Domain d1ap8__: 1ap8 - [40151]

Details for d1ap8__

PDB Entry: 1ap8 (more details)

PDB Description: translation initiation factor eif4e in complex with m7gdp, nmr, 20 structures

SCOP Domain Sequences for d1ap8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap8__ d.86.1.1 (-) Translation initiation factor eIF4e {Baker's yeast (Saccharomyces cerevisiae)}
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlr
gkgadidelwlrtllavigetideddsqingvvlsirkggnkfalwtksedkepllrigg
kfkqvlkltddghleffphssangrhpqpsitl

SCOP Domain Coordinates for d1ap8__:

Click to download the PDB-style file with coordinates for d1ap8__.
(The format of our PDB-style files is described here.)

Timeline for d1ap8__: