Lineage for d1ap8a_ (1ap8 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55422] (2 PDB entries)
  8. Domain d1ap8a_: 1ap8 A: [40151]
    protein/RNA complex; complexed with m7g

Details for d1ap8a_

PDB Entry: 1ap8 (more details)

PDB Description: translation initiation factor eif4e in complex with m7gdp, nmr, 20 structures
PDB Compounds: (A:) translation initiation factor eif4e

SCOPe Domain Sequences for d1ap8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap8a_ d.86.1.1 (A:) Translation initiation factor eIF4e {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlr
gkgadidelwlrtllavigetideddsqingvvlsirkggnkfalwtksedkepllrigg
kfkqvlkltddghleffphssangrhpqpsitl

SCOPe Domain Coordinates for d1ap8a_ are not available.

Timeline for d1ap8a_: