Lineage for d1ejhd_ (1ejh D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81979Fold d.86: Translation initiation factor eIF4e [55417] (1 superfamily)
  4. 81980Superfamily d.86.1: Translation initiation factor eIF4e [55418] (1 family) (S)
  5. 81981Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
  6. 81982Protein Translation initiation factor eIF4e [55420] (2 species)
  7. 81985Species Mouse (Mus musculus) [TaxId:10090] [55421] (3 PDB entries)
  8. 81992Domain d1ejhd_: 1ejh D: [40150]

Details for d1ejhd_

PDB Entry: 1ejh (more details), 2.2 Å

PDB Description: eif4e/eif4g peptide/7-methyl-gdp

SCOP Domain Sequences for d1ejhd_:

Sequence, based on SEQRES records: (download)

>d1ejhd_ d.86.1.1 (D:) Translation initiation factor eIF4e {Mouse (Mus musculus)}
ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
kdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavv
nvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgsttknr
fvv

Sequence, based on observed residues (ATOM records): (download)

>d1ejhd_ d.86.1.1 (D:) Translation initiation factor eIF4e {Mouse (Mus musculus)}
ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
kdgiepmwedeknkrggrwlitlnsdldrfwletllcligesfddysddvcgavvnvrak
gdkiaiwttecenrdavthigrvykerlglppkivigyqshadtnrfvv

SCOP Domain Coordinates for d1ejhd_:

Click to download the PDB-style file with coordinates for d1ejhd_.
(The format of our PDB-style files is described here.)

Timeline for d1ejhd_: