Lineage for d6zata1 (6zat A:3-154)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772349Species Bradyrhizobium sp. [TaxId:566679] [384270] (10 PDB entries)
  8. 2772350Domain d6zata1: 6zat A:3-154 [401496]
    Other proteins in same PDB: d6zata3
    automated match to d1bq5a1
    complexed with cu, epe, gol, no2, so4

Details for d6zata1

PDB Entry: 6zat (more details), 1 Å

PDB Description: nitrite-bound copper nitrite reductase from bradyrhizobium sp. ors 375 (two-domain) at 1.0 a resolution (unrestrained full matrix refinement by shelx)
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6zata1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zata1 b.6.1.0 (A:3-154) automated matches {Bradyrhizobium sp. [TaxId: 566679]}
dlklprqrvdlvappfvhvheqatkqgpkimefklvvqekkmvidekgttfqamtfngsm
pgplmvvhegdyvevtlvnpatntmphnidfhsatgalgggaltlinpgeqvvlrwkatr
tgvfvyhcapggpmipwhvvsgmngavmvlpr

SCOPe Domain Coordinates for d6zata1:

Click to download the PDB-style file with coordinates for d6zata1.
(The format of our PDB-style files is described here.)

Timeline for d6zata1: