Lineage for d1ejha_ (1ejh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962643Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2962644Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2962676Species Mouse (Mus musculus) [TaxId:10090] [55421] (24 PDB entries)
  8. 2962714Domain d1ejha_: 1ejh A: [40147]
    complexed with m7g

Details for d1ejha_

PDB Entry: 1ejh (more details), 2.2 Å

PDB Description: eif4e/eif4g peptide/7-methyl-gdp
PDB Compounds: (A:) eukaryotic initiation factor 4e

SCOPe Domain Sequences for d1ejha_:

Sequence, based on SEQRES records: (download)

>d1ejha_ d.86.1.1 (A:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgstt
knrfvv

Sequence, based on observed residues (ATOM records): (download)

>d1ejha_ d.86.1.1 (A:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfvv

SCOPe Domain Coordinates for d1ejha_:

Click to download the PDB-style file with coordinates for d1ejha_.
(The format of our PDB-style files is described here.)

Timeline for d1ejha_: