Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) |
Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins) Pfam PF02036 |
Protein automated matches [190237] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187005] (3 PDB entries) |
Domain d6z1wa_: 6z1w A: [401450] automated match to d1ikta_ complexed with oxn, so4; mutant |
PDB Entry: 6z1w (more details), 2.48 Å
SCOPe Domain Sequences for d6z1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z1wa_ d.106.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqstfvfeeigrrlkdigpevvkkvnavfewhitkggnigakwtidlksgsgkvyqgpak gaadttiilsdedfmevvlgkldpqkaffsgrlkcrgnimlsqklqmilkdyakl
Timeline for d6z1wa_: