Lineage for d6z1wa_ (6z1w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968251Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 2968265Protein automated matches [190237] (3 species)
    not a true protein
  7. 2968266Species Human (Homo sapiens) [TaxId:9606] [187005] (3 PDB entries)
  8. 2968268Domain d6z1wa_: 6z1w A: [401450]
    automated match to d1ikta_
    complexed with oxn, so4; mutant

Details for d6z1wa_

PDB Entry: 6z1w (more details), 2.48 Å

PDB Description: crystal structure of human steroid carrier protein sl (scp-2l) mutant a100c
PDB Compounds: (A:) Peroxisomal multifunctional enzyme type 2

SCOPe Domain Sequences for d6z1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z1wa_ d.106.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqstfvfeeigrrlkdigpevvkkvnavfewhitkggnigakwtidlksgsgkvyqgpak
gaadttiilsdedfmevvlgkldpqkaffsgrlkcrgnimlsqklqmilkdyakl

SCOPe Domain Coordinates for d6z1wa_:

Click to download the PDB-style file with coordinates for d6z1wa_.
(The format of our PDB-style files is described here.)

Timeline for d6z1wa_: