Lineage for d1ej1b_ (1ej1 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34125Fold d.86: Translation initiation factor eIF4e [55417] (1 superfamily)
  4. 34126Superfamily d.86.1: Translation initiation factor eIF4e [55418] (1 family) (S)
  5. 34127Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
  6. 34128Protein Translation initiation factor eIF4e [55420] (2 species)
  7. 34131Species Mouse (Mus musculus) [TaxId:10090] [55421] (3 PDB entries)
  8. 34133Domain d1ej1b_: 1ej1 B: [40145]

Details for d1ej1b_

PDB Entry: 1ej1 (more details), 2.2 Å

PDB Description: cocrystal structure of the messenger rna 5' cap-binding protein (eif4e) bound to 7-methyl-gdp

SCOP Domain Sequences for d1ej1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej1b_ d.86.1.1 (B:) Translation initiation factor eIF4e {Mouse (Mus musculus)}
vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
gsttknrfvv

SCOP Domain Coordinates for d1ej1b_:

Click to download the PDB-style file with coordinates for d1ej1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ej1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ej1a_