SCOPe 2.08: Domain d1ej1b_: 1ej1 B:

Lineage for d1ej1b_ (1ej1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
   automatically mapped to Pfam PF01652

6. Protein Translation initiation factor eIF4e [55420] (3 species)
   messenger RNA 5' cap-binding protein

7. Species Mouse (Mus musculus) [TaxId:10090] [55421] (24 PDB entries)

8. Domain d1ej1b_: 1ej1 B: [40145]
   protein/RNA complex; complexed with m7g

Details for d1ej1b_

PDB Entry: 1ej1, 2.2 Å

PDB Description: cocrystal structure of the messenger rna 5' cap-binding protein (eif4e) bound to 7-methyl-gdp

PDB Compounds: (B:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d1ej1b_:

Sequence; same for both SEQRES and ATOM records:

>d1ej1b_ d.86.1.1 (B:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
gsttknrfvv

Timeline for d1ej1b_:

• d1ej1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ej1b_ appears in SCOPe 2.07