Lineage for d6yrja_ (6yrj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557381Species Streptomyces lividans [TaxId:1200984] [401340] (4 PDB entries)
  8. 2557388Domain d6yrja_: 6yrj A: [401440]
    automated match to d4gu7a_
    complexed with hem, mg

Details for d6yrja_

PDB Entry: 6yrj (more details), 1.85 Å

PDB Description: sfx structure of dye-type peroxidase dtpb in the ferric state
PDB Compounds: (A:) Putative iron-dependent peroxidase

SCOPe Domain Sequences for d6yrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yrja_ d.58.4.0 (A:) automated matches {Streptomyces lividans [TaxId: 1200984]}
epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
dfledl

SCOPe Domain Coordinates for d6yrja_:

Click to download the PDB-style file with coordinates for d6yrja_.
(The format of our PDB-style files is described here.)

Timeline for d6yrja_: