SCOPe 2.01: Domain d1dwnb_: 1dwn B:

Lineage for d1dwnb_ (1dwn B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein PP7 coat protein [55415] (1 species)

7. Species Bacteriophage PP7 [TaxId:12023] [55416] (1 PDB entry)

8. Domain d1dwnb_: 1dwn B: [40142]

Details for d1dwnb_

PDB Entry: 1dwn, 3.5 Å

PDB Description: Strucure of bacteriophage PP7 from Pseudomonas aeruginosa at 3.7 A resolution

PDB Compounds: (B:) phage coat protein

SCOPe Domain Sequences for d1dwnb_:

Sequence; same for both SEQRES and ATOM records:

>d1dwnb_ d.85.1.1 (B:) PP7 coat protein {Bacteriophage PP7 [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
nlvplgr

Timeline for d1dwnb_:

• d1dwnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dwnb_ appears in SCOP 1.75
  
• d1dwnb_ appears in SCOPe 2.02
  
• d1dwnb_ appears in the current release, SCOPe 2.08