Lineage for d6yq1a_ (6yq1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981484Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 2981492Species Human (Homo sapiens) [TaxId:9606] [103293] (23 PDB entries)
  8. 2981503Domain d6yq1a_: 6yq1 A: [401386]
    Other proteins in same PDB: d6yq1b2
    automated match to d2etmb_
    complexed with na, p7n, so4

Details for d6yq1a_

PDB Entry: 6yq1 (more details), 1.78 Å

PDB Description: focal adhesion kinase catalytic domain in complex with n-methyl-n-(3- {[2-(2-oxo-1,2,3,4-tetrahydro-quinolin-6-ylamino)-5-trifluoromethyl- pyrimidin-4-ylamino]-methyl}-pyridin-2-yl)-methanesulfonamide
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d6yq1a_:

Sequence, based on SEQRES records: (download)

>d6yq1a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesi
nfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlysl
mtkcwaydpsrrprftelkaqlstileeekaq

Sequence, based on observed residues (ATOM records): (download)

>d6yq1a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaklpikwmapesinfr
rftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtk
cwaydpsrrprftelkaqlstileeekaq

SCOPe Domain Coordinates for d6yq1a_:

Click to download the PDB-style file with coordinates for d6yq1a_.
(The format of our PDB-style files is described here.)

Timeline for d6yq1a_: