Lineage for d6ywza1 (6ywz A:654-758)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786102Protein Shank1, PDZ domain [101733] (2 species)
    SH3 and multiple ankyrin repeat domains protein 1
  7. 2786103Species Human (Homo sapiens) [TaxId:9606] [401374] (2 PDB entries)
  8. 2786106Domain d6ywza1: 6ywz A:654-758 [401384]
    Other proteins in same PDB: d6ywza2, d6ywzb2
    automated match to d1q3ob_
    complexed with arg, leu, peg, pwn, thr

Details for d6ywza1

PDB Entry: 6ywz (more details), 2.12 Å

PDB Description: crystal structure of shank1 pdz in complex with a peptide-small molecule hybrid
PDB Compounds: (A:) SH3 and multiple ankyrin repeat domains protein 1

SCOPe Domain Sequences for d6ywza1:

Sequence, based on SEQRES records: (download)

>d6ywza1 b.36.1.1 (A:654-758) Shank1, PDZ domain {Human (Homo sapiens) [TaxId: 9606]}
gsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawr
aglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

Sequence, based on observed residues (ATOM records): (download)

>d6ywza1 b.36.1.1 (A:654-758) Shank1, PDZ domain {Human (Homo sapiens) [TaxId: 9606]}
gsdyiikektvllqkkdsegfgfvlrgakeftptpafpalqylesvdeggvawraglrmg
dflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

SCOPe Domain Coordinates for d6ywza1:

Click to download the PDB-style file with coordinates for d6ywza1.
(The format of our PDB-style files is described here.)

Timeline for d6ywza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ywza2