Lineage for d1fr5c_ (1fr5 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033773Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1033774Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1033775Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1033776Protein fr coat protein [55411] (1 species)
  7. 1033777Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)
  8. 1033783Domain d1fr5c_: 1fr5 C: [40137]

Details for d1fr5c_

PDB Entry: 1fr5 (more details), 3.5 Å

PDB Description: phage fr capsids with a four residue deletion in the coat protein fg loop
PDB Compounds: (C:) bacteriophage fr capsid

SCOPe Domain Sequences for d1fr5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr5c_ d.85.1.1 (C:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
nsgiy

SCOPe Domain Coordinates for d1fr5c_:

Click to download the PDB-style file with coordinates for d1fr5c_.
(The format of our PDB-style files is described here.)

Timeline for d1fr5c_: