![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
![]() | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
![]() | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
![]() | Protein fr coat protein [55411] (1 species) |
![]() | Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries) |
![]() | Domain d1fr5c_: 1fr5 C: [40137] mutant |
PDB Entry: 1fr5 (more details), 3.5 Å
SCOP Domain Sequences for d1fr5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fr5c_ d.85.1.1 (C:) fr coat protein {Bacteriophage FR} asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa nsgiy
Timeline for d1fr5c_: