Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries) |
Domain d6yf3a1: 6yf3 A:1-107 [401367] Other proteins in same PDB: d6yf3a2 automated match to d3kz7a_ complexed with cd, cl, na, ooz |
PDB Entry: 6yf3 (more details), 1 Å
SCOPe Domain Sequences for d6yf3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yf3a1 d.26.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d6yf3a1: