Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin beta subunit [88940] (9 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [401365] (2 PDB entries) |
Domain d6yqgb_: 6yqg B: [401366] Other proteins in same PDB: d6yqga_ automated match to d1ktpb_ complexed with cyc, te4 |
PDB Entry: 6yqg (more details), 1.45 Å
SCOPe Domain Sequences for d6yqgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yqgb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 146786]} mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d6yqgb_: