SCOPe 2.08: Domain d6yqgb_: 6yqg B:

Lineage for d6yqgb_ (6yqg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (9 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [401365] (2 PDB entries)

8. Domain d6yqgb_: 6yqg B: [401366]
   Other proteins in same PDB: d6yqga_
   automated match to d1ktpb_
   complexed with cyc, te4

Details for d6yqgb_

PDB Entry: 6yqg, 1.45 Å

PDB Description: crystal structure of native phycocyanin in spacegroup p63 at 1.45 angstroms.

PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d6yqgb_:

Sequence; same for both SEQRES and ATOM records:

>d6yqgb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 146786]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d6yqgb_:

• d6yqgb_ first appeared in SCOPe 2.07