SCOPe 2.06: Domain d1fr5b_: 1fr5 B:

Lineage for d1fr5b_ (1fr5 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein fr coat protein [55411] (1 species)

7. Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)

8. Domain d1fr5b_: 1fr5 B: [40136]

Details for d1fr5b_

PDB Entry: 1fr5, 3.5 Å

PDB Description: phage fr capsids with a four residue deletion in the coat protein fg loop

PDB Compounds: (B:) bacteriophage fr capsid

SCOPe Domain Sequences for d1fr5b_:

Sequence, based on SEQRES records:

>d1fr5b_ d.85.1.1 (B:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
nsgiy

Sequence, based on observed residues (ATOM records):

>d1fr5b_ d.85.1.1 (B:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaansgiy

Timeline for d1fr5b_:

• d1fr5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fr5b_ appears in SCOPe 2.05
  
• d1fr5b_ appears in SCOPe 2.07
  
• d1fr5b_ appears in the current release, SCOPe 2.08