Lineage for d1fr5b_ (1fr5 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507379Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 507380Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 507381Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 507382Protein fr coat protein [55411] (1 species)
  7. 507383Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)
  8. 507385Domain d1fr5b_: 1fr5 B: [40136]

Details for d1fr5b_

PDB Entry: 1fr5 (more details), 3.5 Å

PDB Description: phage fr capsids with a four residue deletion in the coat protein fg loop

SCOP Domain Sequences for d1fr5b_:

Sequence, based on SEQRES records: (download)

>d1fr5b_ d.85.1.1 (B:) fr coat protein {Bacteriophage FR}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
nsgiy

Sequence, based on observed residues (ATOM records): (download)

>d1fr5b_ d.85.1.1 (B:) fr coat protein {Bacteriophage FR}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaansgiy

SCOP Domain Coordinates for d1fr5b_:

Click to download the PDB-style file with coordinates for d1fr5b_.
(The format of our PDB-style files is described here.)

Timeline for d1fr5b_: