Lineage for d1fr5a_ (1fr5 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728525Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 728526Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 728527Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 728528Protein fr coat protein [55411] (1 species)
  7. 728529Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)
  8. 728530Domain d1fr5a_: 1fr5 A: [40135]

Details for d1fr5a_

PDB Entry: 1fr5 (more details), 3.5 Å

PDB Description: phage fr capsids with a four residue deletion in the coat protein fg loop
PDB Compounds: (A:) bacteriophage fr capsid

SCOP Domain Sequences for d1fr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr5a_ d.85.1.1 (A:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
nsgiy

SCOP Domain Coordinates for d1fr5a_:

Click to download the PDB-style file with coordinates for d1fr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fr5a_: