Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Methanolacinia paynteri [TaxId:694436] [401298] (3 PDB entries) |
Domain d6ykba2: 6ykb A:243-342 [401349] Other proteins in same PDB: d6ykba1, d6ykbc1 automated match to d4jjfa2 complexed with 5gp, fmt, gol |
PDB Entry: 6ykb (more details), 1.55 Å
SCOPe Domain Sequences for d6ykba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ykba2 a.100.1.0 (A:243-342) automated matches {Methanolacinia paynteri [TaxId: 694436]} aeligpvcdmcaaltaityagllvyrdavmnilgapagfsqmmatesleqitaymkkvgi knleenldpgvflgtadsmnfgpiaeilptvlkslekrak
Timeline for d6ykba2: