Lineage for d1frsc_ (1frs C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211268Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1211269Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1211270Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1211271Protein fr coat protein [55411] (1 species)
  7. 1211272Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)
  8. 1211275Domain d1frsc_: 1frs C: [40134]

Details for d1frsc_

PDB Entry: 1frs (more details), 3.5 Å

PDB Description: crystal structure of bacteriophage fr capsids at 3.5 angstroms resolution
PDB Compounds: (C:) bacteriophage fr capsid

SCOPe Domain Sequences for d1frsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frsc_ d.85.1.1 (C:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatqvqggvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiat
aiaansgiy

SCOPe Domain Coordinates for d1frsc_:

Click to download the PDB-style file with coordinates for d1frsc_.
(The format of our PDB-style files is described here.)

Timeline for d1frsc_: