Lineage for d6yk9a2 (6yk9 A:243-342)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721830Species Methanolacinia paynteri [TaxId:694436] [401298] (3 PDB entries)
  8. 2721833Domain d6yk9a2: 6yk9 A:243-342 [401337]
    Other proteins in same PDB: d6yk9a1, d6yk9b1, d6yk9c1, d6yk9e1
    automated match to d4jjfa2
    complexed with 5gp, edo, feg, gly, gmp

Details for d6yk9a2

PDB Entry: 6yk9 (more details), 1.7 Å

PDB Description: [fe]-hydrogenase from methanolacinia paynteri with bound guanylylpyridinol at 1.7-a resolution
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6yk9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yk9a2 a.100.1.0 (A:243-342) automated matches {Methanolacinia paynteri [TaxId: 694436]}
aeligpvcdmcaaltaityagllvyrdavmnilgapagfsqmmatesleqitaymkkvgi
knleenldpgvflgtadsmnfgpiaeilptvlkslekrak

SCOPe Domain Coordinates for d6yk9a2:

Click to download the PDB-style file with coordinates for d6yk9a2.
(The format of our PDB-style files is described here.)

Timeline for d6yk9a2: