Lineage for d1frsb_ (1frs B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728525Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 728526Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 728527Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 728528Protein fr coat protein [55411] (1 species)
  7. 728529Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)
  8. 728534Domain d1frsb_: 1frs B: [40133]

Details for d1frsb_

PDB Entry: 1frs (more details), 3.5 Å

PDB Description: crystal structure of bacteriophage fr capsids at 3.5 angstroms resolution
PDB Compounds: (B:) bacteriophage fr capsid

SCOP Domain Sequences for d1frsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frsb_ d.85.1.1 (B:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatqvqggvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiat
aiaansgiy

SCOP Domain Coordinates for d1frsb_:

Click to download the PDB-style file with coordinates for d1frsb_.
(The format of our PDB-style files is described here.)

Timeline for d1frsb_: