Lineage for d1frsb_ (1frs B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) 
Protein fr coat protein [55411] (1 species) Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries) 
Domain d1frsb_: 1frs B: [40133]
Details for d1frsb_
PDB Entry: 1frs (more details), 3.5 Å
PDB Description: crystal structure of bacteriophage fr capsids at 3.5 angstroms resolution
SCOP Domain Sequences for d1frsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frsb_ d.85.1.1 (B:) fr coat protein {Bacteriophage FR}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatqvqggvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiat
aiaansgiy
SCOP Domain Coordinates for d1frsb_:
Click to download the PDB-style file with coordinates for d1frsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1frsb_:
- d1frsb_ appears in SCOP 1.57
- d1frsb_ appears in the current release, SCOPe 2.08
View in 3D
