Lineage for d6y0jd_ (6y0j D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304491Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
    Uniprot P00044
  8. 2304587Domain d6y0jd_: 6y0j D: [401324]
    automated match to d5t8wa_
    complexed with 7az, evb, hec

Details for d6y0jd_

PDB Entry: 6y0j (more details), 2.7 Å

PDB Description: cytochrome c in complex with phosphonato-calix[6]arene and sulfonato- calix[8]arene
PDB Compounds: (D:) Cytochrome c iso-1

SCOPe Domain Sequences for d6y0jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y0jd_ a.3.1.1 (D:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d6y0jd_:

Click to download the PDB-style file with coordinates for d6y0jd_.
(The format of our PDB-style files is described here.)

Timeline for d6y0jd_: