Lineage for d1frsa_ (1frs A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422709Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1422710Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1422711Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1422712Protein fr coat protein [55411] (1 species)
  7. 1422713Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)
  8. 1422714Domain d1frsa_: 1frs A: [40132]

Details for d1frsa_

PDB Entry: 1frs (more details), 3.5 Å

PDB Description: crystal structure of bacteriophage fr capsids at 3.5 angstroms resolution
PDB Compounds: (A:) bacteriophage fr capsid

SCOPe Domain Sequences for d1frsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frsa_ d.85.1.1 (A:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatqvqggvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiat
aiaansgiy

SCOPe Domain Coordinates for d1frsa_:

Click to download the PDB-style file with coordinates for d1frsa_.
(The format of our PDB-style files is described here.)

Timeline for d1frsa_: