Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein automated matches [190140] (38 species) not a true protein |
Species Escherichia coli [TaxId:83333] [322769] (8 PDB entries) |
Domain d6yedb_: 6yed B: [401306] automated match to d3ttma_ complexed with cl, edo, peg, pge |
PDB Entry: 6yed (more details), 2.18 Å
SCOPe Domain Sequences for d6yedb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yedb_ c.94.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]} qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
Timeline for d6yedb_: