SCOPe 2.08: Domain d6ykbc2: 6ykb C:243-342

Lineage for d6ykbc2 (6ykb C:243-342)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Methanolacinia paynteri [TaxId:694436] [401298] (3 PDB entries)

8. Domain d6ykbc2: 6ykb C:243-342 [401299]
   Other proteins in same PDB: d6ykba1, d6ykbc1
   automated match to d4jjfa2
   complexed with 5gp, fmt, gol

Details for d6ykbc2

PDB Entry: 6ykb, 1.55 Å

PDB Description: [fe]-hydrogenase from methanolacinia paynteri in complex with gmp at 1.55-a resolution

PDB Compounds: (C:) 5,10-methenyltetrahydromethanopterin [Fe]-hydrogenase

SCOPe Domain Sequences for d6ykbc2:

Sequence; same for both SEQRES and ATOM records:

>d6ykbc2 a.100.1.0 (C:243-342) automated matches {Methanolacinia paynteri [TaxId: 694436]}
aeligpvcdmcaaltaityagllvyrdavmnilgapagfsqmmatesleqitaymkkvgi
knleenldpgvflgtadsmnfgpiaeilptvlkslekrak

Timeline for d6ykbc2:

• d6ykbc2 first appeared in SCOPe 2.07