SCOPe 2.08: Domain d6ykbc1: 6ykb C:2-242

Lineage for d6ykbc1 (6ykb C:2-242)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Methanolacinia paynteri [TaxId:694436] [401296] (3 PDB entries)

8. Domain d6ykbc1: 6ykb C:2-242 [401297]
   Other proteins in same PDB: d6ykba2, d6ykbc2
   automated match to d4jjfa1
   complexed with 5gp, fmt, gol

Details for d6ykbc1

PDB Entry: 6ykb, 1.55 Å

PDB Description: [fe]-hydrogenase from methanolacinia paynteri in complex with gmp at 1.55-a resolution

PDB Compounds: (C:) 5,10-methenyltetrahydromethanopterin [Fe]-hydrogenase

SCOPe Domain Sequences for d6ykbc1:

Sequence; same for both SEQRES and ATOM records:

>d6ykbc1 c.2.1.0 (C:2-242) automated matches {Methanolacinia paynteri [TaxId: 694436]}
tikkvailgagcyrthsatgitnfaracevaemvgkpeiamthstiamaaelkylagidn
ivisdpsfageftvvkdfdynevikahkenpetimpkirekvnelaktvpkppkgaihfv
hpedlglkvttddreavrdadliitwlpkgdmqkgiiekfagdikqgaiithactipttl
fykifeelgiadkvevtsyhpgavpemkgqvyiaegyaseeaintiyelgkkarghafkl
p

Timeline for d6ykbc1:

• d6ykbc1 first appeared in SCOPe 2.07