Lineage for d1gav8_ (1gav 8:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607033Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 607034Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 607035Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 607044Protein GA coat protein [55409] (1 species)
  7. 607045Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 607056Domain d1gav8_: 1gav 8: [40129]

Details for d1gav8_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gav8_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gav8_ d.85.1.1 (8:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gav8_:

Click to download the PDB-style file with coordinates for d1gav8_.
(The format of our PDB-style files is described here.)

Timeline for d1gav8_: