Lineage for d6yeda_ (6yed A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522117Species Escherichia coli [TaxId:83333] [322769] (8 PDB entries)
  8. 2522132Domain d6yeda_: 6yed A: [401286]
    automated match to d3ttma_
    complexed with cl, edo, peg, pge

Details for d6yeda_

PDB Entry: 6yed (more details), 2.18 Å

PDB Description: e.coli's putrescine receptor potf in its open apo state
PDB Compounds: (A:) Putrescine-binding periplasmic protein

SCOPe Domain Sequences for d6yeda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yeda_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

SCOPe Domain Coordinates for d6yeda_:

Click to download the PDB-style file with coordinates for d6yeda_.
(The format of our PDB-style files is described here.)

Timeline for d6yeda_: