SCOPe 2.07: Domain d6ye6a_: 6ye6 A:

Lineage for d6ye6a_ (6ye6 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [322769] (8 PDB entries)

8. Domain d6ye6a_: 6ye6 A: [401285]
   automated match to d3ttma_
   complexed with ag2, cl, jfn, ont, onw, so4

Details for d6ye6a_

PDB Entry: 6ye6, 1.56 Å

PDB Description: e.coli's putrescine receptor potf complexed with agmatine

PDB Compounds: (A:) Putrescine-binding periplasmic protein

SCOPe Domain Sequences for d6ye6a_:

Sequence; same for both SEQRES and ATOM records:

>d6ye6a_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

Timeline for d6ye6a_:

• d6ye6a_ is new in SCOPe 2.07-stable
  
• d6ye6a_ appears in the current release, SCOPe 2.08