SCOPe 2.08: Domain d6y08b_: 6y08 B:

Lineage for d6y08b_ (6y08 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)

8. Domain d6y08b_: 6y08 B: [401284]
   automated match to d4eb4a_
   complexed with 08d, ump

Details for d6y08b_

PDB Entry: 6y08, 2.3 Å

PDB Description: mouse thymidylate synthase cocrystallized with dump and soaked in sulfamethoxazole

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d6y08b_:

Sequence; same for both SEQRES and ATOM records:

>d6y08b_ d.117.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleel
lwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaeykd
mdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvngel
scqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplkiq
lqreprpfpklkilrkvetiddfkvedfqiegynphpt

Timeline for d6y08b_:

• d6y08b_ first appeared in SCOPe 2.07