Lineage for d1gav7_ (1gav 7:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569071Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2569072Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2569073Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2569082Protein GA coat protein [55409] (1 species)
  7. 2569083Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 2569093Domain d1gav7_: 1gav 7: [40128]
    contains 9 more identical chains denoted "a b c d e f g h i"

Details for d1gav7_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid
PDB Compounds: (7:) bacteriophage ga protein capsid

SCOPe Domain Sequences for d1gav7_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gav7_ d.85.1.1 (7:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOPe Domain Coordinates for d1gav7_:

Click to download the PDB-style file with coordinates for d1gav7_.
(The format of our PDB-style files is described here.)

Timeline for d1gav7_: