Lineage for d6y1re1 (6y1r E:6-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743762Domain d6y1re1: 6y1r E:6-124 [401264]
    Other proteins in same PDB: d6y1ra2, d6y1ra3, d6y1rb2, d6y1rb3, d6y1rc2, d6y1rc3, d6y1rd2, d6y1rd3, d6y1re2, d6y1re3
    automated match to d2vyre_
    complexed with so4, tb

Details for d6y1re1

PDB Entry: 6y1r (more details), 1.85 Å

PDB Description: nb22-lbt
PDB Compounds: (E:) Nb22-LBT

SCOPe Domain Sequences for d6y1re1:

Sequence, based on SEQRES records: (download)

>d6y1re1 b.1.1.1 (E:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasggtfksggmawfrqagyidtnndgwiegdelykarefaag
iswsggstdyedsvkgrftisrdnakntmylqmnslkpedtavyycaaarrfragvvtra
ddvdywgkgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d6y1re1 b.1.1.1 (E:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasggtsggmawfrqagyidtnndgwiegdelykarefaagis
wsggstdyedsvkgrftisrdnakntmylqmnslkpedtavyycaaagvvtraddvdywg
kgtqvtv

SCOPe Domain Coordinates for d6y1re1:

Click to download the PDB-style file with coordinates for d6y1re1.
(The format of our PDB-style files is described here.)

Timeline for d6y1re1: