Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
Domain d6y1rd1: 6y1r D:6-124 [401236] Other proteins in same PDB: d6y1ra2, d6y1ra3, d6y1rb2, d6y1rb3, d6y1rc2, d6y1rc3, d6y1rd2, d6y1rd3, d6y1re2, d6y1re3 automated match to d2vyre_ complexed with so4, tb |
PDB Entry: 6y1r (more details), 1.85 Å
SCOPe Domain Sequences for d6y1rd1:
Sequence, based on SEQRES records: (download)
>d6y1rd1 b.1.1.1 (D:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqaggslrlscaasggtfksggmawfrqagyidtnndgwiegdelykarefaag iswsggstdyedsvkgrftisrdnakntmylqmnslkpedtavyycaaarrfragvvtra ddvdywgkgtqvtv
>d6y1rd1 b.1.1.1 (D:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqaggslrlscaasggksggmawfrqagyidtnndgwiegdelykarefaagis wsggstdyedsvkgrftisrdnakntmylqmnslkpedtavyycaaarrfragvvtradd vdywgkgtqvtv
Timeline for d6y1rd1: