SCOPe 2.08: Domain d6xz2b_: 6xz2 B:

Lineage for d6xz2b_ (6xz2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)

7. Species Escherichia coli [TaxId:83333] [401168] (1 PDB entry)

8. Domain d6xz2b_: 6xz2 B: [401235]
   automated match to d5i3ca_
   complexed with fmc, so4; mutant

Details for d6xz2b_

PDB Entry: 6xz2, 1.65 Å

PDB Description: crystal structure of e. coli purine nucleoside phosphorylase mutant y160w with so4 and formycin a

PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d6xz2b_:

Sequence; same for both SEQRES and ATOM records:

>d6xz2b_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 83333]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfwspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

Timeline for d6xz2b_:

• d6xz2b_ first appeared in SCOPe 2.07