Lineage for d6vqsa_ (6vqs A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2494110Protein automated matches [190209] (5 species)
    not a true protein
  7. 2494111Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)
  8. 2494233Domain d6vqsa_: 6vqs A: [401201]
    automated match to d3vq9c_
    complexed with iod, r7j, so4

Details for d6vqsa_

PDB Entry: 6vqs (more details), 2.38 Å

PDB Description: hiv integrase core domain (in) in complex with [5-(3-fluorophenyl)-1- benzofuran-3-yl]acetic acid
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6vqsa_:

Sequence, based on SEQRES records: (download)

>d6vqsa_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiat

Sequence, based on observed residues (ATOM records): (download)

>d6vqsa_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgnkelkkiigqvrdqaehlktavqmavfihnkkrkgg
iggysagerivdiiat

SCOPe Domain Coordinates for d6vqsa_:

Click to download the PDB-style file with coordinates for d6vqsa_.
(The format of our PDB-style files is described here.)

Timeline for d6vqsa_: