![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255147] (5 PDB entries) |
![]() | Domain d6xlra3: 6xlr A:538-639 [401198] Other proteins in same PDB: d6xlra1, d6xlra2 automated match to d1gofa1 complexed with 2lt, act, ca, cu, gol |
PDB Entry: 6xlr (more details), 1.23 Å
SCOPe Domain Sequences for d6xlra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xlra3 b.1.18.0 (A:538-639) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d6xlra3: