SCOPe 2.07: Domain d6xrub1: 6xru B:1-245

Lineage for d6xrub1 (6xru B:1-245)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
   automatically mapped to Pfam PF13549
   automatically mapped to Pfam PF08442

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries)
   GTP-specific enzyme

8. Domain d6xrub1: 6xru B:1-245 [401155]
   Other proteins in same PDB: d6xrua1, d6xrua2, d6xrua3, d6xrub2
   automated match to d2nu8b2
   complexed with dca, edo, gol, mg, po4, sin

Details for d6xrub1

PDB Entry: 6xru, 1.4 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with desulfo-coenzyme a, magnesium ions and succinates

PDB Compounds: (B:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d6xrub1:

Sequence; same for both SEQRES and ATOM records:

>d6xrub1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

Timeline for d6xrub1:

• d6xrub1 is new in SCOPe 2.07-stable
  
• d6xrub1 appears in the current release, SCOPe 2.08