Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) automatically mapped to Pfam PF13549 automatically mapped to Pfam PF08442 |
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries) GTP-specific enzyme |
Domain d6xrub1: 6xru B:1-245 [401155] Other proteins in same PDB: d6xrua1, d6xrua2, d6xrua3, d6xrub2 automated match to d2nu8b2 complexed with dca, edo, gol, mg, po4, sin |
PDB Entry: 6xru (more details), 1.4 Å
SCOPe Domain Sequences for d6xrub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xrub1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd dksen
Timeline for d6xrub1: