Lineage for d6xymb1 (6xym B:6-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355843Domain d6xymb1: 6xym B:6-124 [401137]
    Other proteins in same PDB: d6xyma2, d6xyma3, d6xymb2, d6xymb3
    automated match to d4heme_
    complexed with tb

Details for d6xymb1

PDB Entry: 6xym (more details), 1.2 Å

PDB Description: nbe-lbm
PDB Compounds: (B:) Nbe-LBM

SCOPe Domain Sequences for d6xymb1:

Sequence, based on SEQRES records: (download)

>d6xymb1 b.1.1.1 (B:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasggtfksggmawfrqadtnndgwiegdelkarefaagisws
ggstdyedsvkgrftisrdnakntmylqmnslkpedtavyycaaarrfragvvtraddvd
ywgkgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d6xymb1 b.1.1.1 (B:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasggksggmawfrqadtnndgwiegdelkarefaagiswgst
dyedsvkgrftisrdnakntmylqmnslkpedtavyycaaarrfragvvtraddvdywgk
gtqvtv

SCOPe Domain Coordinates for d6xymb1:

Click to download the PDB-style file with coordinates for d6xymb1.
(The format of our PDB-style files is described here.)

Timeline for d6xymb1: