| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255147] (5 PDB entries) |
| Domain d6xlta3: 6xlt A:538-639 [401110] Other proteins in same PDB: d6xlta1, d6xlta2 automated match to d1gofa1 complexed with act, ca, cu, gol |
PDB Entry: 6xlt (more details), 1.48 Å
SCOPe Domain Sequences for d6xlta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xlta3 b.1.18.0 (A:538-639) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d6xlta3: