Lineage for d6xlta3 (6xlt A:538-639)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766299Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255147] (5 PDB entries)
  8. 2766301Domain d6xlta3: 6xlt A:538-639 [401110]
    Other proteins in same PDB: d6xlta1, d6xlta2
    automated match to d1gofa1
    complexed with act, ca, cu, gol

Details for d6xlta3

PDB Entry: 6xlt (more details), 1.48 Å

PDB Description: the 1.48 angstrom crystal structure of evolved galactose oxidase variant a3.e7
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d6xlta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xlta3 b.1.18.0 (A:538-639) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d6xlta3:

Click to download the PDB-style file with coordinates for d6xlta3.
(The format of our PDB-style files is described here.)

Timeline for d6xlta3: