SCOPe 2.08: Domain d6xlsa3: 6xls A:538-639

Lineage for d6xlsa3 (6xls A:538-639)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255147] (5 PDB entries)

8. Domain d6xlsa3: 6xls A:538-639 [401075]
   Other proteins in same PDB: d6xlsa1, d6xlsa2
   automated match to d1gofa1
   complexed with act, ca, cu, f2y, gol

Details for d6xlsa3

PDB Entry: 6xls, 1.8 Å

PDB Description: the 1.80 angstrom crystal structure of galactose oxidase variant with genetically incorporated f2-tyr272

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d6xlsa3:

Sequence; same for both SEQRES and ATOM records:

>d6xlsa3 b.1.18.0 (A:538-639) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d6xlsa3:

• d6xlsa3 first appeared in SCOPe 2.07