Lineage for d6xjub_ (6xju B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413229Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2413230Protein automated matches [190052] (8 species)
    not a true protein
  7. 2413231Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries)
  8. 2413242Domain d6xjub_: 6xju B: [401064]
    Other proteins in same PDB: d6xjua_
    automated match to d5uwsb_
    complexed with 6l8, gnp, mg

Details for d6xjub_

PDB Entry: 6xju (more details), 2.19 Å

PDB Description: crystal structure of kpt-8602 bound to crm1 (e582k, 537-dltvk-541 to glceq)
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d6xjub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xjub_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkican
hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei
nkk

SCOPe Domain Coordinates for d6xjub_:

Click to download the PDB-style file with coordinates for d6xjub_.
(The format of our PDB-style files is described here.)

Timeline for d6xjub_: