SCOPe 2.07: Domain d6xcra1: 6xcr A:1-36

Lineage for d6xcra1 (6xcr A:1-36)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.30: Oligosaccharyltransferase subunit ost4p [103464] (1 family)
   automatically mapped to Pfam PF10215

5. Family f.23.30.1: Oligosaccharyltransferase subunit ost4p [103465] (2 proteins)

6. Protein automated matches [401047] (1 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:307796] [401048] (2 PDB entries)

8. Domain d6xcra1: 6xcr A:1-36 [401049]
   Other proteins in same PDB: d6xcra2
   automated match to d1rkla_

Details for d6xcra1

PDB Entry: 6xcr

PDB Description: nmr structure of ost4 in dpc micelles

PDB Compounds: (A:) Oligosaccharyltransferase

SCOPe Domain Sequences for d6xcra1:

Sequence; same for both SEQRES and ATOM records:

>d6xcra1 f.23.30.1 (A:1-36) automated matches {Saccharomyces cerevisiae [TaxId: 307796]}
misdeqlnslaitfgivmmtliviyhavdstmspkn

Timeline for d6xcra1:

• d6xcra1 is new in SCOPe 2.07-stable
  
• d6xcra1 appears in the current release, SCOPe 2.08