Lineage for d6xcra1 (6xcr A:1-36)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026382Superfamily f.23.30: Oligosaccharyltransferase subunit ost4p [103464] (1 family) (S)
    automatically mapped to Pfam PF10215
  5. 3026383Family f.23.30.1: Oligosaccharyltransferase subunit ost4p [103465] (2 proteins)
  6. 3026387Protein automated matches [401047] (1 species)
    not a true protein
  7. 3026388Species Saccharomyces cerevisiae [TaxId:307796] [401048] (2 PDB entries)
  8. 3026390Domain d6xcra1: 6xcr A:1-36 [401049]
    Other proteins in same PDB: d6xcra2
    automated match to d1rkla_

Details for d6xcra1

PDB Entry: 6xcr (more details)

PDB Description: nmr structure of ost4 in dpc micelles
PDB Compounds: (A:) Oligosaccharyltransferase

SCOPe Domain Sequences for d6xcra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xcra1 f.23.30.1 (A:1-36) automated matches {Saccharomyces cerevisiae [TaxId: 307796]}
misdeqlnslaitfgivmmtliviyhavdstmspkn

SCOPe Domain Coordinates for d6xcra1:

Click to download the PDB-style file with coordinates for d6xcra1.
(The format of our PDB-style files is described here.)

Timeline for d6xcra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6xcra2